PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M00027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 250aa    MW: 27861.9 Da    PI: 7.4312
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M00027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.81.1e-33145202259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vkg+++prsYYrC+ agCpvkk+ver+++d ++v++tYeg+H+he
  Migut.M00027.1.p 145 NDGYRWRKYGQKLVKGNPNPRSYYRCSNAGCPVKKHVERASHDSRLVITTYEGQHEHE 202
                       8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-4131IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-34132204IPR003657WRKY domain
SuperFamilySSF1182905.36E-29136204IPR003657WRKY domain
PROSITE profilePS5081135.037139204IPR003657WRKY domain
SMARTSM007743.1E-38144203IPR003657WRKY domain
PfamPF031069.6E-27145201IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
NCQAKKQVER SHDGCKTDIN YLGTHHHQKP QHSSQVTPVF QVQETPIVSA IKADAEPIID  60
HGGANLQMVP FGTSHQSIVP RSADDVIVAV PCSTNDDNNN YNKEDYSDTK RQRREIISGD  120
ENVVSKPHSE LRHVVQTLSG VDVINDGYRW RKYGQKLVKG NPNPRSYYRC SNAGCPVKKH  180
VERASHDSRL VITTYEGQHE HEMPLPRPPV NQSTPRNDAN TITANGESRP KPEENNPVSL  240
EMVVHLTAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-35132204274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1825671e-141AC182567.2 Erythranthe guttata clone MGBa-50E20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830745.10.0PREDICTED: WRKY transcription factor 1, partial
TrEMBLA0A022RSJ31e-133A0A022RSJ3_ERYGU; Uncharacterized protein
STRINGSolyc12g006170.1.11e-61(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-48WRKY family protein